PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g054680.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 816aa    MW: 91497.4 Da    PI: 8.8685
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g054680.2genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B368.11.2e-2196191199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f+k  + +  ++++rl+lp +f++e+g+++++  ++ l  ++g +W  +l  ++++gr++l++GWk+FvkangLk+g++v+++l + +++ +v++
  Csa07g054680.2  96 FIKFRLAPVDGRHCRLRLPMQFTRENGINTPG--KIYLLGKDGSKWLANLLLENTRGRMTLGDGWKSFVKANGLKTGESVTLRLCW-EDTIPVLS 187
                     77888888999****************99766..8*************************************************99.77778988 PP

                     EE-S CS
              B3  96 vfrk 99 
                     ++++
  Csa07g054680.2 188 LCSE 191
                     8875 PP

2B368.31e-21249339498
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      ++++d+lk+grl+lp +f++e++++k++  ++tl  ++g +W v l    k+gr+ l+kGWk+F+kangL++ D+++++l++ +++++ ++++r
  Csa07g054680.2 249 LTITPDSLKHGRLRLPLQFMAENNMDKPG--EITLLGKDGAKWLVSLL-LEKRGRMSLGKGWKDFAKANGLRTDDSITLELIW-ENATPILHLLR 339
                     6789*******************999766..8***************5.66667889**************************.77778887765 PP

3B367.22.3e-21579661186
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                     f++ ++++d+l++grl+lp +f++e++++k++  ++tl  ++g +W v l    ++gr+ l+kGWk+F+k+ngLk+gD+++F+ +g
  Csa07g054680.2 579 FLTLTITPDSLRHGRLRLPLDFMTENNMNKPG--EITLLGKNGAKWLVSLL-LERRGRMSLGKGWKNFAKENGLKTGDSITFESIG 661
                     778899********************999766..8***************5.55556789**********************9554 PP

4B349.95.6e-16724809493
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                      ++++   + g l lp kf++ +g++k++  ++tl  + g +W  +l    ++g++vl++GWk+F++ang+  gD+++++++ +++++ v
  Csa07g054680.2 724 LTLTPEDVRDGTLHLPSKFMRINGINKPG--QITLLGRGGMKWFAYL--LPRDGTVVLGNGWKGFCEANGVMLGDSFILEFIPKEDTNHV 809
                     455566666778********999999877..6***************..*******************************9966666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.1E-2193190IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.7E-2094191IPR015300DNA-binding pseudobarrel domain
PfamPF023627.5E-2196191IPR003340B3 DNA binding domain
PROSITE profilePS5086314.84796192IPR003340B3 DNA binding domain
CDDcd100171.13E-1896190No hitNo description
SMARTSM010191.1E-2996192IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.2E-21238335IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-22242337IPR015300DNA-binding pseudobarrel domain
CDDcd100177.13E-20245339No hitNo description
PROSITE profilePS5086315.312246341IPR003340B3 DNA binding domain
SMARTSM010193.8E-30246341IPR003340B3 DNA binding domain
PfamPF023628.2E-21248339IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.1E-21574669IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.94E-23575670IPR015300DNA-binding pseudobarrel domain
PfamPF023624.5E-20579661IPR003340B3 DNA binding domain
PROSITE profilePS5086316.525579676IPR003340B3 DNA binding domain
CDDcd100179.79E-19579671No hitNo description
SMARTSM010191.5E-27579674IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.3E-19713810IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.47E-22715811IPR015300DNA-binding pseudobarrel domain
CDDcd100171.58E-15720814No hitNo description
PfamPF023624.8E-15721811IPR003340B3 DNA binding domain
PROSITE profilePS5086314.085721815IPR003340B3 DNA binding domain
SMARTSM010191.4E-19721814IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 816 aa     Download sequence    Send to blast
MANSLILGSP INPEKDMMIQ VSDHQNNNIE FQRKKKVKQN NTETEADCSY FNAHVTASSQ  60
QSGRLYLPQD FTSSSGLIRK CSKSPPQIIS SSDKNFIKFR LAPVDGRHCR LRLPMQFTRE  120
NGINTPGKIY LLGKDGSKWL ANLLLENTRG RMTLGDGWKS FVKANGLKTG ESVTLRLCWE  180
DTIPVLSLCS EEYITDTRVG KKCSEASEKE PLPTVPETKK DESSSWKREN NHMRCIDSTS  240
PSQNHILTLT ITPDSLKHGR LRLPLQFMAE NNMDKPGEIT LLGKDGAKWL VSLLLEKRGR  300
MSLGKGWKDF AKANGLRTDD SITLELIWEN ATPILHLLRI ESSSGRGECD FSKESLPIEP  360
NSGNKARNSD NNREESKKYP PGSRESSSAI QNQFMALTRP SGIISQGALH LQTNEVFIYR  420
NEGGNMLQIS DLGPYFFGIR DVPAPSSNND HDRIGNISMK MHPHLRKEAG FSSYDGDDHD  480
NFERQSKKRV RKNDPETEEN CSSDHTRFGA HVTTTSNLHT NELRLAAKES LPIGPSVEKK  540
ISEGENSKDK NNMVESSSCG REENHLRCIA SISPSQNRFL TLTITPDSLR HGRLRLPLDF  600
MTENNMNKPG EITLLGKNGA KWLVSLLLER RGRMSLGKGW KNFAKENGLK TGDSITFESI  660
GLNASHVLSL LYIESSSVRG QSEFPKESHL TNREERNSRE LEKRTYCPSI QNSSSDIQNR  720
FLTLTLTPED VRDGTLHLPS KFMRINGINK PGQITLLGRG GMKWFAYLLP RDGTVVLGNG  780
WKGFCEANGV MLGDSFILEF IPKEDTNHVF NFYSI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010417226.10.0PREDICTED: B3 domain-containing protein REM-like 1 isoform X2
RefseqXP_010417225.10.0PREDICTED: B3 domain-containing protein REM-like 1 isoform X1
SwissprotQ8S8E80.0REML1_ARATH; B3 domain-containing protein REM-like 1
TrEMBLR0FUN00.0R0FUN0_9BRAS; Uncharacterized protein (Fragment)
STRINGAT2G24690.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24690.10.0B3 family protein